PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G69580.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 337aa    MW: 38038.3 Da    PI: 6.7148
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G69580.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.7e-323488155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 kprl+Wt++LH++F+eav+qLGG++kAtPk ++++m+++gLtl+h+kSHLQkYRl
  AT1G69580.2 34 KPRLKWTCDLHHKFIEAVNQLGGPNKATPKGLMKVMEIPGLTLYHLKSHLQKYRL 88
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-283289IPR009057Homeodomain-like
SuperFamilySSF466894.66E-153388IPR009057Homeodomain-like
TIGRFAMsTIGR015579.9E-223489IPR006447Myb domain, plants
PfamPF002498.1E-63687IPR001005SANT/Myb domain
PfamPF143795.5E-23138184IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MCLLMEINNN ANNTNTTIDN HKAKMSLVLS TDAKPRLKWT CDLHHKFIEA VNQLGGPNKA  60
TPKGLMKVME IPGLTLYHLK SHLQKYRLGK SMKFDDNKLE VSSASENQEV ESKNDSRDLR  120
GCSVTEENSN PAKDRGLQIT EALQMQMEVQ KKLHEQIEVQ RHLQVKIEAQ GKYLQSVLMK  180
AQQTLAGYSS SNLGMDFART ELSRLASMVN RGCPSTSFSE LTQVEEEEEG FLWYKKPENR  240
GISQLRCSVE SSLTSSETSE TKLDTDNNLN KSIELPLMEI NSEVMKGKKR SINDVVCVEQ  300
PLMKRAFGVD DDEHLKLSLN TYKKDMEACT NIGLGFN
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible259832_at0.0
Expression AtlasAT1G69580-
AtGenExpressAT1G69580-
ATTED-IIAT1G69580-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G69580.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G69580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0295160.0BT029516.1 Arabidopsis thaliana At1g69580 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077798.10.0homeodomain-like superfamily protein
TrEMBLA8MSE50.0A8MSE5_ARATH; Homeodomain-like superfamily protein
STRINGAT1G69580.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38782759
Representative plantOGRP7817262
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Sottosanto JB,Saranga Y,Blumwald E
    Impact of AtNHX1, a vacuolar Na+/H+ antiporter, upon gene expression during short- and long-term salt stress in Arabidopsis thaliana.
    BMC Plant Biol., 2007. 7: p. 18
    [PMID:17411438]
  3. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]